Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries) |
Domain d5m3na1: 5m3n A:142-343 [340467] Other proteins in same PDB: d5m3na2, d5m3na3 automated match to d1lcya2 complexed with mes |
PDB Entry: 5m3n (more details), 1.65 Å
SCOPe Domain Sequences for d5m3na1:
Sequence, based on SEQRES records: (download)
>d5m3na1 b.47.1.1 (A:142-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg spfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigvn tmkvtagisfaipsdrlreflh
>d5m3na1 b.47.1.1 (A:142-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg spfalqntitsgivssaqeyiqtdaaidfgnsggplvnldgevigvntmkvtagisfaip sdrlreflh
Timeline for d5m3na1: