SCOPe 2.08: Domain d5xi7b1: 5xi7 B:1-243

Lineage for d5xi7b1 (5xi7 B:1-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries)

8. Domain d5xi7b1: 5xi7 B:1-243 [340405]
   Other proteins in same PDB: d5xi7a2, d5xi7b2, d5xi7c2, d5xi7d2, d5xi7e_, d5xi7f1, d5xi7f2, d5xi7f3
   automated match to d4drxb1
   complexed with acp, ca, gdp, gtp, mes, mg, po7

Details for d5xi7b1

PDB Entry: 5xi7, 2.99 Å

PDB Description: crystal structure of t2r-ttl bound with po-7

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5xi7b1:

Sequence; same for both SEQRES and ATOM records:

>d5xi7b1 c.32.1.1 (B:1-243) automated matches {Sus barbatus [TaxId: 41807]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5xi7b1:

• d5xi7b1 first appeared in SCOPe 2.06
  
• d5xi7b1 appears in SCOPe 2.07