Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d5xi7f3: 5xi7 F:77-378 [344451] Other proteins in same PDB: d5xi7a1, d5xi7a2, d5xi7b1, d5xi7b2, d5xi7c1, d5xi7c2, d5xi7d1, d5xi7d2, d5xi7e_, d5xi7f1, d5xi7f2 complexed with acp, ca, gdp, gtp, mes, mg, po7 |
PDB Entry: 5xi7 (more details), 2.99 Å
SCOPe Domain Sequences for d5xi7f3:
Sequence, based on SEQRES records: (download)
>d5xi7f3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5xi7f3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviypgnvwiaksgilisseahviqkylekplllepghr kfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqknygryeegne mffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmv deelkvwlievngapacaqklyaelcqgivdvaissvfplasifikl
Timeline for d5xi7f3: