SCOPe 2.08: Domain d5xi7a2: 5xi7 A:246-437

Lineage for d5xi7a2 (5xi7 A:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)

8. Domain d5xi7a2: 5xi7 A:246-437 [340416]
   Other proteins in same PDB: d5xi7a1, d5xi7b1, d5xi7c1, d5xi7d1, d5xi7e_, d5xi7f1, d5xi7f2, d5xi7f3
   automated match to d4i50a2
   complexed with acp, ca, gdp, gtp, mes, mg, po7

Details for d5xi7a2

PDB Entry: 5xi7, 2.99 Å

PDB Description: crystal structure of t2r-ttl bound with po-7

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d5xi7a2:

Sequence; same for both SEQRES and ATOM records:

>d5xi7a2 d.79.2.1 (A:246-437) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d5xi7a2:

• d5xi7a2 first appeared in SCOPe 2.06
  
• d5xi7a2 appears in SCOPe 2.07