SCOPe 2.08: Domain d5tmaa3: 5tma A:363-567

Lineage for d5tmaa3 (5tma A:363-567)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries)

8. Domain d5tmaa3: 5tma A:363-567 [340328]
   Other proteins in same PDB: d5tmaa2, d5tmab2
   automated match to d1zpda3
   complexed with edo, mg, so4, tpp; mutant

Details for d5tmaa3

PDB Entry: 5tma, 1.67 Å

PDB Description: zymomonas mobilis pyruvate decarboxylase mutant pdc-2.3

PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d5tmaa3:

Sequence; same for both SEQRES and ATOM records:

>d5tmaa3 c.36.1.0 (A:363-567) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqiedlltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaalmevfngnggydsgagkglkaktaaeleeaikvaldntdgptliecfiare
dcteelvkwgervaaansrkpvnkl

Timeline for d5tmaa3:

• d5tmaa3 first appeared in SCOPe 2.06
  
• d5tmaa3 appears in SCOPe 2.07