| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries) |
| Domain d5tmaa2: 5tma A:188-362 [340327] Other proteins in same PDB: d5tmaa1, d5tmaa3, d5tmab1, d5tmab3 automated match to d1zpda1 complexed with edo, mg, so4, tpp; mutant |
PDB Entry: 5tma (more details), 1.67 Å
SCOPe Domain Sequences for d5tmaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmaa2 c.31.1.0 (A:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfienrdkvavlvgsklraaaaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaekvskktgaldffkslnagelkkadpadps
Timeline for d5tmaa2: