Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [340214] (1 PDB entry) |
Domain d6b8da1: 6b8d A:1-288 [340215] Other proteins in same PDB: d6b8da2 automated match to d2efga2 complexed with cl |
PDB Entry: 6b8d (more details), 1.78 Å
SCOPe Domain Sequences for d6b8da1:
Sequence, based on SEQRES records: (download)
>d6b8da1 c.37.1.0 (A:1-288) automated matches {Haemophilus influenzae [TaxId: 71421]} marttpieryrnigisahidagktttterilfytgvshkigevhdgaatmdwmeqeqerg ititsaattafwsgmsqqfpqhrinvidtpghvdftveversmrvldgavmvycavggvq pqsetvwrqankyevpriafvnkmdrtganflrvveqlktrlganaiplqlpvgaeenft gvvdlikmkainwneadqgmtftyeevpanmqadceewrqnlveaaaeaseelmekylgg edlteeeiksalrqrvlaneiilvtcgsafknkgvqamldavveylpa
>d6b8da1 c.37.1.0 (A:1-288) automated matches {Haemophilus influenzae [TaxId: 71421]} marttpieryrnigisahidagktttterilfytgvshkigetsaattafwsgmsqqfpq hrinvidtptveversmrvldgavmvycavggvqpqsetvwrqankyevpriafvnkmdr tganflrvveqlktrlganaiplqlpvgaeenftgvvdlikmkainwneadqgmtftyee vpanmqadceewrqnlveaaaeaseelmekylggedlteeeiksalrqrvlaneiilvtc gsafknkgvqamldavveylpa
Timeline for d6b8da1: