Lineage for d6b8da1 (6b8d A:1-288)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452253Species Haemophilus influenzae [TaxId:71421] [340214] (1 PDB entry)
  8. 2452254Domain d6b8da1: 6b8d A:1-288 [340215]
    Other proteins in same PDB: d6b8da2
    automated match to d2efga2
    complexed with cl

Details for d6b8da1

PDB Entry: 6b8d (more details), 1.78 Å

PDB Description: 1.78 angstrom resolution crystal structure of n-terminal fragment (residues 1-405) of elongation factor g from haemophilus influenzae
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d6b8da1:

Sequence, based on SEQRES records: (download)

>d6b8da1 c.37.1.0 (A:1-288) automated matches {Haemophilus influenzae [TaxId: 71421]}
marttpieryrnigisahidagktttterilfytgvshkigevhdgaatmdwmeqeqerg
ititsaattafwsgmsqqfpqhrinvidtpghvdftveversmrvldgavmvycavggvq
pqsetvwrqankyevpriafvnkmdrtganflrvveqlktrlganaiplqlpvgaeenft
gvvdlikmkainwneadqgmtftyeevpanmqadceewrqnlveaaaeaseelmekylgg
edlteeeiksalrqrvlaneiilvtcgsafknkgvqamldavveylpa

Sequence, based on observed residues (ATOM records): (download)

>d6b8da1 c.37.1.0 (A:1-288) automated matches {Haemophilus influenzae [TaxId: 71421]}
marttpieryrnigisahidagktttterilfytgvshkigetsaattafwsgmsqqfpq
hrinvidtptveversmrvldgavmvycavggvqpqsetvwrqankyevpriafvnkmdr
tganflrvveqlktrlganaiplqlpvgaeenftgvvdlikmkainwneadqgmtftyee
vpanmqadceewrqnlveaaaeaseelmekylggedlteeeiksalrqrvlaneiilvtc
gsafknkgvqamldavveylpa

SCOPe Domain Coordinates for d6b8da1:

Click to download the PDB-style file with coordinates for d6b8da1.
(The format of our PDB-style files is described here.)

Timeline for d6b8da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b8da2