Lineage for d6b8da2 (6b8d A:289-405)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2386349Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2386350Protein automated matches [226946] (28 species)
    not a true protein
  7. 2386407Species Haemophilus influenzae [TaxId:71421] [340216] (1 PDB entry)
  8. 2386408Domain d6b8da2: 6b8d A:289-405 [340217]
    Other proteins in same PDB: d6b8da1
    automated match to d2efga1
    complexed with cl

Details for d6b8da2

PDB Entry: 6b8d (more details), 1.78 Å

PDB Description: 1.78 angstrom resolution crystal structure of n-terminal fragment (residues 1-405) of elongation factor g from haemophilus influenzae
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d6b8da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b8da2 b.43.3.0 (A:289-405) automated matches {Haemophilus influenzae [TaxId: 71421]}
ptdipaikginpdetegerhasdeepfsslafkiatdpfvgnltffrvysgvinsgdtvl
nsvrqkrerfgrivqmhankreeikevragdiaaaiglkdvttgdtlcaidapiile

SCOPe Domain Coordinates for d6b8da2:

Click to download the PDB-style file with coordinates for d6b8da2.
(The format of our PDB-style files is described here.)

Timeline for d6b8da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b8da1