SCOPe 2.08: Domain d5o74d_: 5o74 D:

Lineage for d5o74d_ (5o74 D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d5o74d_: 5o74 D: [340036]
   automated match to d3l0ib_
   complexed with gdp

Details for d5o74d_

PDB Entry: 5o74, 2.5 Å

PDB Description: crystal structure of human rab1b covalently bound to the gef domain of drra/sidm from legionella pneumophila in the presence of gdp

PDB Compounds: (D:) Ras-related protein Rab-1B

SCOPe Domain Sequences for d5o74d_:

Sequence, based on SEQRES records:

>d5o74d_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyxgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm

Sequence, based on observed residues (ATOM records):

>d5o74d_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtyxgahgiivvydvtdqesyanvkqwlqeidryvnkllvgnksdlttkkvvd
nttakefadslgipfletsaknatnveqafmtmaaeikkrm

Timeline for d5o74d_:

• d5o74d_ first appeared in SCOPe 2.06
  
• d5o74d_ appears in SCOPe 2.07