SCOPe 2.06: Domain d6axfp_: 6axf P:

Lineage for d6axfp_ (6axf P:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d6axfp_: 6axf P: [339965]
   automated match to d4hdob_

Details for d6axfp_

PDB Entry: 6axf, 3.1 Å

PDB Description: structure of rasgrp2 in complex with rap1b

PDB Compounds: (P:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d6axfp_:

Sequence; same for both SEQRES and ATOM records:

>d6axfp_ c.37.1.8 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Timeline for d6axfp_:

• d6axfp_ is new in SCOPe 2.06-stable
  
• d6axfp_ appears in SCOPe 2.07
  
• d6axfp_ appears in the current release, SCOPe 2.08