PDB entry 6axf

View 6axf on RCSB PDB site
Description: Structure of RasGRP2 in complex with Rap1B
Class: protein binding
Keywords: signaling protein, protein binding
Deposited on 2017-09-06, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfb_
  • Chain 'C':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfd_
  • Chain 'E':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axff_
  • Chain 'G':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfh_
  • Chain 'I':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfj_
  • Chain 'K':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfl_
  • Chain 'M':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfn_
  • Chain 'O':
    Compound: RAS guanyl-releasing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RASGRP2, CDC25L, MCG7
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6axfp_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6axfB (B:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfB (B:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6axfD (D:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfD (D:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6axfF (F:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfF (F:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqin
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6axfH (H:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfH (H:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6axfJ (J:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfJ (J:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6axfL (L:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfL (L:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6axfN (N:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfN (N:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6axfP (P:)
    gamreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axfP (P:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr