SCOPe 2.08: Domain d5omnc1: 5omn C:1-111

Lineage for d5omnc1 (5omn C:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5omnc1: 5omn C:1-111 [339840]
   Other proteins in same PDB: d5omnb_, d5omnc2
   automated match to d4ldeb_

Details for d5omnc1

PDB Entry: 5omn, 2.68 Å

PDB Description: gii.10 vietnam 026 protruding domain in complex with nanobody nano-27

PDB Compounds: (C:) Nanobody (VHH) Nano-27

SCOPe Domain Sequences for d5omnc1:

Sequence; same for both SEQRES and ATOM records:

>d5omnc1 b.1.1.1 (C:1-111) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlqesggglvqpggslrlscaasgtifsrnimgwyrqapgkerelvasiysdrstwya
esvegrftisrdnvkntlylqmnslkpedtamyycrdrtlgswgqgtqvtv

Timeline for d5omnc1:

• d5omnc1 first appeared in SCOPe 2.06
  
• d5omnc1 appears in SCOPe 2.07