Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (5 PDB entries) |
Domain d5w8ua1: 5w8u A:2-61 [339688] Other proteins in same PDB: d5w8ua2, d5w8uc2 automated match to d4pt5a1 complexed with aye, mpd, zn |
PDB Entry: 5w8u (more details), 2.41 Å
SCOPe Domain Sequences for d5w8ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w8ua1 d.15.1.0 (A:2-61) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]} ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
Timeline for d5w8ua1:
View in 3D Domains from other chains: (mouse over for more information) d5w8ub_, d5w8uc1, d5w8uc2, d5w8ud_ |