| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
| Protein Papain-like protease PLpro, catalytic domain [310795] (3 species) |
| Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311427] (5 PDB entries) |
| Domain d5w8uc2: 5w8u C:62-320 [339682] Other proteins in same PDB: d5w8ua1, d5w8ub_, d5w8uc1, d5w8ud_ automated match to d4pt5a2 complexed with aye, mpd, zn |
PDB Entry: 5w8u (more details), 2.41 Å
SCOPe Domain Sequences for d5w8uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w8uc2 d.3.1.23 (C:62-320) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssd
Timeline for d5w8uc2:
View in 3DDomains from other chains: (mouse over for more information) d5w8ua1, d5w8ua2, d5w8ub_, d5w8ud_ |