Lineage for d1e0da2 (1e0d A:298-437)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498723Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2498724Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2498725Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 2498742Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 2498743Species Escherichia coli [TaxId:562] [53247] (7 PDB entries)
  8. 2498750Domain d1e0da2: 1e0d A:298-437 [33956]
    Other proteins in same PDB: d1e0da1, d1e0da3
    complexed with so4

Details for d1e0da2

PDB Entry: 1e0d (more details), 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d1e0da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0da2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d1e0da2:

Click to download the PDB-style file with coordinates for d1e0da2.
(The format of our PDB-style files is described here.)

Timeline for d1e0da2: