Lineage for d1e0da1 (1e0d A:1-93)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458695Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2458696Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2458697Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 2458710Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 2458711Species Escherichia coli [TaxId:562] [51987] (7 PDB entries)
  8. 2458718Domain d1e0da1: 1e0d A:1-93 [30655]
    Other proteins in same PDB: d1e0da2, d1e0da3
    complexed with so4

Details for d1e0da1

PDB Entry: 1e0d (more details), 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d1e0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0da1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d1e0da1:

Click to download the PDB-style file with coordinates for d1e0da1.
(The format of our PDB-style files is described here.)

Timeline for d1e0da1: