Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
Protein automated matches [190108] (16 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries) |
Domain d5gxxb1: 5gxx B:30-471 [339452] Other proteins in same PDB: d5gxxa2, d5gxxa3, d5gxxb2 automated match to d1tf4a1 complexed with ca, cl, trs |
PDB Entry: 5gxx (more details), 1.5 Å
SCOPe Domain Sequences for d5gxxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gxxb1 a.102.1.0 (B:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]} synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc rltaeyggtplanfpppeqrdd
Timeline for d5gxxb1: