Lineage for d5gxxb1 (5gxx B:30-471)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335407Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2335408Protein automated matches [190108] (21 species)
    not a true protein
  7. 2335427Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries)
  8. 2335429Domain d5gxxb1: 5gxx B:30-471 [339452]
    Other proteins in same PDB: d5gxxa2, d5gxxa3, d5gxxb2
    automated match to d1tf4a1
    complexed with ca, cl, trs

Details for d5gxxb1

PDB Entry: 5gxx (more details), 1.5 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with tris
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5gxxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxxb1 a.102.1.0 (B:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]}
synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc
rltaeyggtplanfpppeqrdd

SCOPe Domain Coordinates for d5gxxb1:

Click to download the PDB-style file with coordinates for d5gxxb1.
(The format of our PDB-style files is described here.)

Timeline for d5gxxb1: