Lineage for d5ydbd_ (5ydb D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466085Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2466535Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 2466536Protein automated matches [191250] (6 species)
    not a true protein
  7. 2466539Species Acinetobacter baumannii [TaxId:400667] [260788] (7 PDB entries)
  8. 2466543Domain d5ydbd_: 5ydb D: [339403]
    automated match to d4rc9a_
    complexed with dqa, na

Details for d5ydbd_

PDB Entry: 5ydb (more details), 1.76 Å

PDB Description: crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5ydbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ydbd_ c.23.13.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
igvicglgakgysfaldyaiekiqp

SCOPe Domain Coordinates for d5ydbd_:

Click to download the PDB-style file with coordinates for d5ydbd_.
(The format of our PDB-style files is described here.)

Timeline for d5ydbd_: