Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d5nw0c_: 5nw0 C: [339378] Other proteins in same PDB: d5nw0a_, d5nw0b1, d5nw0b2, d5nw0d_, d5nw0e1, d5nw0e2, d5nw0g_, d5nw0h1, d5nw0h2, d5nw0j_, d5nw0k1, d5nw0k2 automated match to d1lqbc_ complexed with 9bk |
PDB Entry: 5nw0 (more details), 2.3 Å
SCOPe Domain Sequences for d5nw0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nw0c_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerlt
Timeline for d5nw0c_: