| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
| Domain d5nw0b1: 5nw0 B:17-112 [339251] Other proteins in same PDB: d5nw0a_, d5nw0b2, d5nw0c_, d5nw0d_, d5nw0e2, d5nw0f_, d5nw0g_, d5nw0h2, d5nw0i_, d5nw0j_, d5nw0k2, d5nw0l_ automated match to d1lm8c_ complexed with 9bk |
PDB Entry: 5nw0 (more details), 2.3 Å
SCOPe Domain Sequences for d5nw0b1:
Sequence, based on SEQRES records: (download)
>d5nw0b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d5nw0b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc
Timeline for d5nw0b1: