SCOPe 2.08: Domain d5nw0h1: 5nw0 H:17-112

Lineage for d5nw0h1 (5nw0 H:17-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)

8. Domain d5nw0h1: 5nw0 H:17-112 [339257]
   Other proteins in same PDB: d5nw0a_, d5nw0b2, d5nw0c_, d5nw0d_, d5nw0e2, d5nw0f_, d5nw0g_, d5nw0h2, d5nw0i_, d5nw0j_, d5nw0k2, d5nw0l_
   automated match to d1lm8c_
   complexed with 9bk

Details for d5nw0h1

PDB Entry: 5nw0, 2.3 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-(1- acetamidocyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n- (4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 17)

PDB Compounds: (H:) Elongin-C

SCOPe Domain Sequences for d5nw0h1:

Sequence, based on SEQRES records:

>d5nw0h1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d5nw0h1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

Timeline for d5nw0h1:

• d5nw0h1 first appeared in SCOPe 2.06
  
• d5nw0h1 appears in SCOPe 2.07