Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d5nw2b1: 5nw2 B:17-112 [339162] Other proteins in same PDB: d5nw2a_, d5nw2b2, d5nw2c_, d5nw2d_, d5nw2e2, d5nw2f_, d5nw2g_, d5nw2h2, d5nw2i_, d5nw2j_, d5nw2k2, d5nw2l_ automated match to d1lm8c_ complexed with 9b8 |
PDB Entry: 5nw2 (more details), 2.2 Å
SCOPe Domain Sequences for d5nw2b1:
Sequence, based on SEQRES records: (download)
>d5nw2b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d5nw2b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns steipefpiapeialellmaanfldc
Timeline for d5nw2b1: