![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
![]() | Family b.3.3.1: VHL [49469] (2 proteins) |
![]() | Protein VHL [49470] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
![]() | Domain d5nw2c_: 5nw2 C: [339116] Other proteins in same PDB: d5nw2a_, d5nw2b1, d5nw2b2, d5nw2d_, d5nw2e1, d5nw2e2, d5nw2g_, d5nw2h1, d5nw2h2, d5nw2j_, d5nw2k1, d5nw2k2 automated match to d1lqbc_ complexed with 9b8 |
PDB Entry: 5nw2 (more details), 2.2 Å
SCOPe Domain Sequences for d5nw2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nw2c_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerlt
Timeline for d5nw2c_: