Lineage for d5nw2d_ (5nw2 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931286Domain d5nw2d_: 5nw2 D: [339175]
    Other proteins in same PDB: d5nw2b1, d5nw2b2, d5nw2c_, d5nw2e1, d5nw2e2, d5nw2f_, d5nw2h1, d5nw2h2, d5nw2i_, d5nw2k1, d5nw2k2, d5nw2l_
    automated match to d1lqba_
    complexed with 9b8

Details for d5nw2d_

PDB Entry: 5nw2 (more details), 2.2 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-3,3-dimethyl-2-(oxetane- 3-carboxamido)butanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl) pyrrolidine-2-carboxamide (ligand 19)
PDB Compounds: (D:) Elongin-B

SCOPe Domain Sequences for d5nw2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw2d_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5nw2d_:

Click to download the PDB-style file with coordinates for d5nw2d_.
(The format of our PDB-style files is described here.)

Timeline for d5nw2d_: