SCOPe 2.06: Domain d5lxsd2: 5lxs D:246-441

Lineage for d5lxsd2 (5lxs D:246-441)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)

8. Domain d5lxsd2: 5lxs D:246-441 [339140]
   Other proteins in same PDB: d5lxsa1, d5lxsb1, d5lxsc1, d5lxsd1, d5lxse_, d5lxsf1, d5lxsf2, d5lxsf3
   automated match to d3rycd2
   complexed with 7ao, acp, ca, gdp, gtp, mes, mg

Details for d5lxsd2

PDB Entry: 5lxs, 2.2 Å

PDB Description: tubulin-ks-1-199-32 complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5lxsd2:

Sequence; same for both SEQRES and ATOM records:

>d5lxsd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Timeline for d5lxsd2:

• d5lxsd2 is new in SCOPe 2.06-stable
  
• d5lxsd2 appears in SCOPe 2.07
  
• d5lxsd2 appears in the current release, SCOPe 2.08