![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries) |
![]() | Domain d5lxsd2: 5lxs D:246-441 [339140] Other proteins in same PDB: d5lxsa1, d5lxsb1, d5lxsc1, d5lxsd1, d5lxse_, d5lxsf1, d5lxsf2, d5lxsf3 automated match to d3rycd2 complexed with 7ao, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5lxs (more details), 2.2 Å
SCOPe Domain Sequences for d5lxsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lxsd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
Timeline for d5lxsd2: