SCOPe 2.06: Domain d3rycd2: 3ryc D:246-441

Lineage for d3rycd2 (3ryc D:246-441)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (5 species)
not a true protein
Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
Domain d3rycd2: 3ryc D:246-441 [200544]
Other proteins in same PDB: d3ryca1, d3rycb1, d3rycc1, d3rycd1, d3ryce1, d3ryce2
automated match to d1z2bb2
complexed with gdp, gtp, mg, so4

Details for d3rycd2

PDB Entry: 3ryc (more details), 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d3rycd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rycd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d3rycd2:

Click to download the PDB-style file with coordinates for d3rycd2.
(The format of our PDB-style files is described here.)

Timeline for d3rycd2: