Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries) |
Domain d5knya_: 5kny A: [339089] automated match to d4rhua_ complexed with mg, ypg |
PDB Entry: 5kny (more details), 2.91 Å
SCOPe Domain Sequences for d5knya_:
Sequence, based on SEQRES records: (download)
>d5knya_ c.61.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} elypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdla raipvptqfefmavssygsstsssgvvrilkdldrdihgrdvlivedvvdsgltlswlsr nltsrnprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtl dprvy
>d5knya_ c.61.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} elypgdiksvlltaeqiqariaelgeqigndyrgqdlllitvlkgavlfvtdlaraipvp tqfefmavssygsssgvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrnprs lrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvy
Timeline for d5knya_: