Lineage for d4rhua_ (4rhu A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499680Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2499681Protein automated matches [190891] (38 species)
    not a true protein
  7. 2499883Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries)
  8. 2499888Domain d4rhua_: 4rhu A: [272974]
    automated match to d3kb8b_
    complexed with 3qe, 45t, mg

Details for d4rhua_

PDB Entry: 4rhu (more details), 2.57 Å

PDB Description: crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease
PDB Compounds: (A:) Hypoxanthine-guanine phosphoribosyltransferase Hpt

SCOPe Domain Sequences for d4rhua_:

Sequence, based on SEQRES records: (download)

>d4rhua_ c.61.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qtaelypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvt
dlaraipvptqfefmavssygsstsssgvvrilkdldrdihgrdvlivedvvdsgltlsw
lsrnltsrnprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyi
gtldprvyq

Sequence, based on observed residues (ATOM records): (download)

>d4rhua_ c.61.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qtaelypgdiksvlltaeqiqariaelgeqigndyrettgqdlllitvlkgavlfvtdla
raipvptqfefmavssysgvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrn
prslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvyq

SCOPe Domain Coordinates for d4rhua_:

Click to download the PDB-style file with coordinates for d4rhua_.
(The format of our PDB-style files is described here.)

Timeline for d4rhua_: