Lineage for d5x0zd_ (5x0z D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502350Species Helicobacter pylori [TaxId:85962] [225261] (5 PDB entries)
  8. 2502359Domain d5x0zd_: 5x0z D: [339020]
    automated match to d2cmga_
    complexed with flc

Details for d5x0zd_

PDB Entry: 5x0z (more details), 2.7 Å

PDB Description: crystal structure of flim-spee complex from h. pylori
PDB Compounds: (D:) Polyamine Aminopropyltransferase

SCOPe Domain Sequences for d5x0zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x0zd_ c.66.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
mwitqeitpylrkeytieaklldvrsehnileifkskdfgeiamlnrqllfknflhiese
llahmggctkkelkevlivdgfdlelahqlfkydthidfvqadekildsfisffphfhev
knnknfthakqlldldikkydlifclqepdihridglkrmlkedgvfisvakhpllehvs
mqnalknmggvfsvampfvaplrilsnkgyiyasfkthplkdlmtpkiealtsvryyned
ihraafalpknlqevfkdniks

SCOPe Domain Coordinates for d5x0zd_:

Click to download the PDB-style file with coordinates for d5x0zd_.
(The format of our PDB-style files is described here.)

Timeline for d5x0zd_: