| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
| Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
| Protein automated matches [190689] (81 species) not a true protein |
| Species Helicobacter pylori [TaxId:85962] [225261] (5 PDB entries) |
| Domain d5x0za_: 5x0z A: [339017] automated match to d2cmga_ complexed with flc |
PDB Entry: 5x0z (more details), 2.7 Å
SCOPe Domain Sequences for d5x0za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x0za_ c.66.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mwitqeitpylrkeytieaklldvrsehnileifkskdfgeiamlnrqllfknflhiese
llahmggctkkelkevlivdgfdlelahqlfkydthidfvqadekildsfisffphfhev
knnknfthakqlldldikkydlifclqepdihridglkrmlkedgvfisvakhpllehvs
mqnalknmggvfsvampfvaplrilsnkgyiyasfkthplkdlmtpkiealtsvryyned
ihraafalpknlqevfkdniks
Timeline for d5x0za_: