Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (15 PDB entries) |
Domain d5v2cb_: 5v2c B: [338869] Other proteins in same PDB: d5v2ca_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_ automated match to d4il6b_ complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd |
PDB Entry: 5v2c (more details), 1.9 Å
SCOPe Domain Sequences for d5v2cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v2cb_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpelspeqvewgfyqkvgdvttr
Timeline for d5v2cb_: