Lineage for d5v2ci_ (5v2c I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254921Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2254922Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2254923Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2254934Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (10 PDB entries)
  8. 2254939Domain d5v2ci_: 5v2c I: [338777]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
    automated match to d4ub8i_
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2ci_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5v2ci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2ci_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d5v2ci_:

Click to download the PDB-style file with coordinates for d5v2ci_.
(The format of our PDB-style files is described here.)

Timeline for d5v2ci_: