Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d5vxjh_: 5vxj H: [338785] Other proteins in same PDB: d5vxja_, d5vxjc_, d5vxje_, d5vxjg_, d5vxji_ automated match to d1mqkh_ |
PDB Entry: 5vxj (more details), 2.5 Å
SCOPe Domain Sequences for d5vxjh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vxjh_ b.1.1.1 (H:) automated matches {Vicugna pacos [TaxId: 30538]} qvqlaetggglaqpggslrlscaasgftfsravmnwyrqapgkerelvariydaggngsi adpvkgrftisrdnakntvhlqmnslkpedtamyvcnagifdgnyrtywgqgtqvtvss
Timeline for d5vxjh_: