Lineage for d5vxjh_ (5vxj H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020506Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)
  8. 2295484Domain d5vxjh_: 5vxj H: [338785]
    Other proteins in same PDB: d5vxja_, d5vxjc_, d5vxje_, d5vxjg_, d5vxji_
    automated match to d1mqkh_

Details for d5vxjh_

PDB Entry: 5vxj (more details), 2.5 Å

PDB Description: 2.50 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jmk-e3
PDB Compounds: (H:) single-domain antibody JMK-E3

SCOPe Domain Sequences for d5vxjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vxjh_ b.1.1.1 (H:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlaetggglaqpggslrlscaasgftfsravmnwyrqapgkerelvariydaggngsi
adpvkgrftisrdnakntvhlqmnslkpedtamyvcnagifdgnyrtywgqgtqvtvss

SCOPe Domain Coordinates for d5vxjh_:

Click to download the PDB-style file with coordinates for d5vxjh_.
(The format of our PDB-style files is described here.)

Timeline for d5vxjh_:

  • d5vxjh_ appears in periodic updates to SCOPe 2.06 starting on 2017-09-08