![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
![]() | Protein automated matches [190239] (20 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [338697] (2 PDB entries) |
![]() | Domain d5v91a_: 5v91 A: [338726] automated match to d4jh2a_ complexed with zn |
PDB Entry: 5v91 (more details), 1.3 Å
SCOPe Domain Sequences for d5v91a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v91a_ d.32.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla qrlaacreqpykgmvffe
Timeline for d5v91a_: