Lineage for d5v91a_ (5v91 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942951Species Klebsiella pneumoniae [TaxId:573] [338697] (3 PDB entries)
  8. 2942952Domain d5v91a_: 5v91 A: [338726]
    automated match to d4jh2a_
    complexed with zn

Details for d5v91a_

PDB Entry: 5v91 (more details), 1.3 Å

PDB Description: crystal structure of fosfomycin resistance protein from klebsiella pneumoniae
PDB Compounds: (A:) Fosfomycin resistance protein

SCOPe Domain Sequences for d5v91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v91a_ d.32.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
qrlaacreqpykgmvffe

SCOPe Domain Coordinates for d5v91a_:

Click to download the PDB-style file with coordinates for d5v91a_.
(The format of our PDB-style files is described here.)

Timeline for d5v91a_: