Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (21 species) not a true protein |
Species Lactococcus lactis [TaxId:1360] [338684] (1 PDB entry) |
Domain d5ue9a_: 5ue9 A: [338685] Other proteins in same PDB: d5ue9b1, d5ue9b2, d5ue9d1, d5ue9d2 automated match to d1ep3a_ complexed with cl, fad, fes, fmn, gol, oro |
PDB Entry: 5ue9 (more details), 2.72 Å
SCOPe Domain Sequences for d5ue9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue9a_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1360]} nrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnptprva etasgmlnaiglqnpglevimaeklpwlnenfpdlpiianvagseeddyvavcakigdap nvkvielniscpnvkhggqafgtdpdvaaalvkackavskvplyvklspnvtdivpiaka veaagadgltmintlmgvrfdlktrkpvlanitgglsgpaikpvalklihqvaqvvdipi igmggvesaqdvlemymagasavavgtanfadpfvcpkiieklpevmdqygidslenliq evknsk
Timeline for d5ue9a_: