Lineage for d5ue9a_ (5ue9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436963Protein automated matches [190228] (21 species)
    not a true protein
  7. 2436999Species Lactococcus lactis [TaxId:1360] [338684] (1 PDB entry)
  8. 2437000Domain d5ue9a_: 5ue9 A: [338685]
    Other proteins in same PDB: d5ue9b1, d5ue9b2, d5ue9d1, d5ue9d2
    automated match to d1ep3a_
    complexed with cl, fad, fes, fmn, gol, oro

Details for d5ue9a_

PDB Entry: 5ue9 (more details), 2.72 Å

PDB Description: wt dhodb with orotate bound
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d5ue9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue9a_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1360]}
nrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnptprva
etasgmlnaiglqnpglevimaeklpwlnenfpdlpiianvagseeddyvavcakigdap
nvkvielniscpnvkhggqafgtdpdvaaalvkackavskvplyvklspnvtdivpiaka
veaagadgltmintlmgvrfdlktrkpvlanitgglsgpaikpvalklihqvaqvvdipi
igmggvesaqdvlemymagasavavgtanfadpfvcpkiieklpevmdqygidslenliq
evknsk

SCOPe Domain Coordinates for d5ue9a_:

Click to download the PDB-style file with coordinates for d5ue9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ue9a_: