Lineage for d5p9da_ (5p9d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892682Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2892698Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)
  8. 2892733Domain d5p9da_: 5p9d A: [338641]
    automated match to d1h1da_
    complexed with 77r, d1d, k, mg, so4

Details for d5p9da_

PDB Entry: 5p9d (more details), 1.42 Å

PDB Description: rat catechol o-methyltransferase in complex with 5-(4-fluorophenyl)-2, 3-dihydroxy-n-(5-imidazol-1-ylpentyl)benzamide at 1.42a
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5p9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5p9da_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5p9da_:

Click to download the PDB-style file with coordinates for d5p9da_.
(The format of our PDB-style files is described here.)

Timeline for d5p9da_: