![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82796] (90 PDB entries) Uniprot P00533 702-1018 |
![]() | Domain d5gtyb_: 5gty B: [338508] automated match to d3ikaa_ complexed with 816, edo |
PDB Entry: 5gty (more details), 3.14 Å
SCOPe Domain Sequences for d5gtyb_:
Sequence, based on SEQRES records: (download)
>d5gtyb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpik wmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppic tidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyr almdeedmddvvdad
>d5gtyb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeildea yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqs dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
Timeline for d5gtyb_: