Lineage for d5ni4b2 (5ni4 B:209-460)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964698Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2964714Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 2964715Species Human (Homo sapiens) [TaxId:9606] [64340] (58 PDB entries)
    Uniprot P09960
  8. 2964743Domain d5ni4b2: 5ni4 B:209-460 [338375]
    Other proteins in same PDB: d5ni4a1, d5ni4a3, d5ni4b1, d5ni4b3, d5ni4c1, d5ni4c3
    automated match to d3u9wa2
    complexed with dj3, imd, zn; mutant

Details for d5ni4b2

PDB Entry: 5ni4 (more details), 1.9 Å

PDB Description: crystal structure of human lta4h mutant e271a in complex with lta4 (crystal form ii)
PDB Compounds: (B:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5ni4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ni4b2 d.92.1.13 (B:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmanpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d5ni4b2:

Click to download the PDB-style file with coordinates for d5ni4b2.
(The format of our PDB-style files is described here.)

Timeline for d5ni4b2: