Lineage for d5ni4a3 (5ni4 A:461-609)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725727Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 2725728Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 2725729Species Human (Homo sapiens) [TaxId:9606] [63610] (58 PDB entries)
    Uniprot P09960
  8. 2725756Domain d5ni4a3: 5ni4 A:461-609 [338199]
    Other proteins in same PDB: d5ni4a1, d5ni4a2, d5ni4b1, d5ni4b2, d5ni4c1, d5ni4c2
    automated match to d3u9wa3
    complexed with dj3, imd, zn; mutant

Details for d5ni4a3

PDB Entry: 5ni4 (more details), 1.9 Å

PDB Description: crystal structure of human lta4h mutant e271a in complex with lta4 (crystal form ii)
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5ni4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ni4a3 a.118.1.7 (A:461-609) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkv

SCOPe Domain Coordinates for d5ni4a3:

Click to download the PDB-style file with coordinates for d5ni4a3.
(The format of our PDB-style files is described here.)

Timeline for d5ni4a3: