Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64340] (58 PDB entries) Uniprot P09960 |
Domain d3u9wa2: 3u9w A:1209-1460 [250161] Other proteins in same PDB: d3u9wa1, d3u9wa3 automated match to d3funa2 complexed with 28p, act, cl, gol, imd, yb, zn |
PDB Entry: 3u9w (more details), 1.25 Å
SCOPe Domain Sequences for d3u9wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u9wa2 d.92.1.13 (A:1209-1460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d3u9wa2: