SCOPe 2.08: Domain d5v71d1: 5v71 D:1-168

Lineage for d5v71d1 (5v71 D:1-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d5v71d1: 5v71 D:1-168 [338313]
   Other proteins in same PDB: d5v71a2, d5v71b2, d5v71c2, d5v71d2, d5v71e2, d5v71f2
   automated match to d4obea_
   complexed with 8zg, gdp, mg

Details for d5v71d1

PDB Entry: 5v71, 2.23 Å

PDB Description: kras g12c in bound to quinazoline based switch ii pocket (swiip) binder

PDB Compounds: (D:) GTPase KRas

SCOPe Domain Sequences for d5v71d1:

Sequence; same for both SEQRES and ATOM records:

>d5v71d1 c.37.1.8 (D:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d5v71d1:

• d5v71d1 first appeared in SCOPe 2.06
  
• d5v71d1 appears in SCOPe 2.07