Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.12: eEF-1beta-like [54984] (1 family) automatically mapped to Pfam PF00736 |
Family d.58.12.1: eEF-1beta-like [54985] (3 proteins) |
Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries) |
Domain d5o8wb_: 5o8w B: [338245] automated match to d1f60b_ complexed with gln, pge |
PDB Entry: 5o8w (more details), 1.67 Å
SCOPe Domain Sequences for d5o8wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o8wb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pakpaaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincv veddkvslddlqqsieededhvqstdiaamqkl
Timeline for d5o8wb_: