PDB entry 5o8w

View 5o8w on RCSB PDB site
Description: crystal structure analysis of the yeast elongation factor complex eef1a:eef1ba
Class: translation
Keywords: protein-protein complex, translation, covalent modification
Deposited on 2017-06-14, released 2017-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02994
      • expression tag (458-465)
  • Chain 'B':
    Compound: elongation factor 1-beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: EFB1, TEF5, YAL003W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5o8wb_
  • Heterogens: GLN, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o8wB (B:)
    kpakpaaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqinc
    vveddkvslddlqqsieededhvqstdiaamqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o8wB (B:)
    pakpaaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincv
    veddkvslddlqqsieededhvqstdiaamqkl