Lineage for d5uv5c2 (5uv5 C:430-554)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2140276Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2140277Protein automated matches [190396] (35 species)
    not a true protein
  7. 2140407Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (20 PDB entries)
  8. 2140428Domain d5uv5c2: 5uv5 C:430-554 [337930]
    Other proteins in same PDB: d5uv5a1, d5uv5b1, d5uv5b2, d5uv5c1, d5uv5d_
    automated match to d1dloa1
    complexed with mn, y55

Details for d5uv5c2

PDB Entry: 5uv5 (more details), 3 Å

PDB Description: crystal structure of a 2-hydroxyisoquinoline-1,3-dione rnase h active site inhibitor with multiple binding modes to hiv reverse transcriptase
PDB Compounds: (C:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d5uv5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uv5c2 c.55.3.0 (C:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d5uv5c2:

Click to download the PDB-style file with coordinates for d5uv5c2.
(The format of our PDB-style files is described here.)

Timeline for d5uv5c2: