SCOPe 2.07: Domain d5uv5c2: 5uv5 C:430-554

Lineage for d5uv5c2 (5uv5 C:430-554)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)

8. Domain d5uv5c2: 5uv5 C:430-554 [337930]
   Other proteins in same PDB: d5uv5a1, d5uv5b1, d5uv5b2, d5uv5c1, d5uv5d_
   automated match to d1dloa1
   complexed with mn, y55

Details for d5uv5c2

PDB Entry: 5uv5, 3 Å

PDB Description: crystal structure of a 2-hydroxyisoquinoline-1,3-dione rnase h active site inhibitor with multiple binding modes to hiv reverse transcriptase

PDB Compounds: (C:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d5uv5c2:

Sequence; same for both SEQRES and ATOM records:

>d5uv5c2 c.55.3.0 (C:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d5uv5c2:

• d5uv5c2 first appeared in SCOPe 2.06
  
• d5uv5c2 appears in the current release, SCOPe 2.08