SCOPe 2.08: Domain d5xgtb_: 5xgt B:

Lineage for d5xgtb_ (5xgt B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:46170] [337735] (1 PDB entry)

8. Domain d5xgtb_: 5xgt B: [337771]
   automated match to d2vw9a_
   complexed with gol

Details for d5xgtb_

PDB Entry: 5xgt, 1.82 Å

PDB Description: crystal structure of the n-terminal domain of staphylococcus aureus single-stranded dna-binding protein ssba at 1.82 angstrom resolution

PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d5xgtb_:

Sequence; same for both SEQRES and ATOM records:

>d5xgtb_ b.40.4.0 (B:) automated matches {Staphylococcus aureus [TaxId: 46170]}
mlnrvvlvgrltkdpeyrttpsgvsvatftlavnrtftnaqgereadfincvvfrrqadn
vnnylskgslagvdgrlqsrnyenqegrrvfvtevvcdsvqflep

Timeline for d5xgtb_:

• d5xgtb_ first appeared in SCOPe 2.06
  
• d5xgtb_ appears in SCOPe 2.07