PDB entry 5xgt

View 5xgt on RCSB PDB site
Description: Crystal structure of the N-terminal domain of Staphylococcus aureus single-stranded DNA-binding protein SsbA at 1.82 angstrom resolution
Class: DNA binding protein
Keywords: single-strand DNA binding protein, SsbA, DNA BINDING PROTEIN
Deposited on 2017-04-17, released 2017-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:46170]
    Gene: ssb_1, A7U48_3558, AS852_01830, BJI72_0272, EDCC5055_00340, QU38_04380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xgta_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:46170]
    Gene: ssb_1, A7U48_3558, AS852_01830, BJI72_0272, EDCC5055_00340, QU38_04380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xgtb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5xgtA (A:)
mlnrvvlvgrltkdpeyrttpsgvsvatftlavnrtftnaqgereadfincvvfrrqadn
vnnylskgslagvdgrlqsrnyenqegrrvfvtevvcdsvqflephhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5xgtA (A:)
mlnrvvlvgrltkdpeyrttpsgvsvatftlavnrtftnaqgereadfincvvfrrqadn
vnnylskgslagvdgrlqsrnyenqegrrvfvtevvcdsvqfle

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5xgtB (B:)
mlnrvvlvgrltkdpeyrttpsgvsvatftlavnrtftnaqgereadfincvvfrrqadn
vnnylskgslagvdgrlqsrnyenqegrrvfvtevvcdsvqflephhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5xgtB (B:)
mlnrvvlvgrltkdpeyrttpsgvsvatftlavnrtftnaqgereadfincvvfrrqadn
vnnylskgslagvdgrlqsrnyenqegrrvfvtevvcdsvqflep